Sequence: MTLQELVHKAASCYMDRVAVCFDECNNQLPVYYTYKTVVNAASELSNFLLLHCDFQGIREIGLYCQPGIDLPSWILGILQVPAAYVPIEPDSPPSLSTHFMKKCNLKYILVEKKQINVSLDVSIVFCLYYIYFN
2-aminoadipic 6-semialdehyde dehydrogenase; ACSF4/LYS2/NRPS1098/NRPS998; Acyl-CoA synthetase family member 4; Beta-alanine-activating enzyme; non-ribosomal peptide synthetase 1098; non-ribosomal peptide synthetase 998; Protein NRPS998
Cat # 16116109
50 µg
Cat # 15715571
100 µL
Cat # 15725571
100 µL
Cat # 16382165
100 µL
Cat # 15848363
100 µL
Searching for an antibody we don't offer? We make custom antibodies for specific targets, species and applications.
More than 18,000 custom antibodies created so far.
Talk To A Specialist NowIf an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.