Sequence: MYTLEASGQGCVYVQTVLRYNILPPTNMKTFSLSVEIGKARCEQPTSPRSLTLTIHTSYVGSRSSSNMAIVEVKMLSGFSPMEGTNQLLLQQPLVKKVEFGTDTLNIYLDELIKNTQTYTFTISQSVLVTNLKPATIKVYDYYLPDEQATIQYSDPCE
alpha-2-macroglobulin-like 1; Alpha-2-macroglobulin-like protein 1; C3 and PZP-like alpha-2-macroglobulin domain-containing protein 9; C3 and PZP-like, alpha-2-macroglobulin domain containing 9; CPAMD9/DKFZp686C1729/DKFZp686D2011/DKFZp686G1812/DKFZp686L1821/DKFZp686O1010/FLJ16045/FLJ25179/FLJ39129/FLJ41597/FLJ41598/FLJ41607
Cat # 16126319
50 µg
Cat # 16116319
50 µL
Cat # 15736441
100 µL
Cat # 16560252
100 µg
Cat # 15726441
100 µL
Searching for an antibody we don't offer? We make custom antibodies for specific targets, species and applications.
More than 18,000 custom antibodies created so far.
Talk To A Specialist NowIf an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.