missing translation for 'onlineSavingsMsg'
Learn More

enQuireBio™ Recombinant Rainbow Trout GH Protein

A cDNA sequence encoding the GH was constructed and used to recombinantly synthesize the protein.

Marca:  enQuireBio™ QP10630-2ug

Detalles adicionales : Peso : 0.01000kg

 Ver más versiones de este producto

Código de producto. 15934468

  • 103.00€ / 2 microgramos


Fecha estimada de envío
18-10-2019
Añadir a la cesta

Especificaciones

Especificaciones

GH Protein
2 μg
< 1.0 EU per ug protein as determined by the LAL method.
Recombinant Protein
E. coli
AIENQRLFNIAVSRVQHLHLLAQKMFNDFDGTLLPDERRQLNKIFLLDFCNSDSIVSPVDKHETQKSSVLKLLHISFRLIESWEYPSQTLIISNSLMVRNANQISEKLSDLKVGINLLITGSQDGVLSLDDNDSQQLPPYGNYYQNLGGDGNVRRNYELLACFKKDMHKVETYLTVAKCRKSLEANCTL
Greater than 95.0% as determined by:(a) Analysis by SEC-HPLC. (b) Analysis by SDS-PAGE.
Research Use Only
Somatotropin Rainbow Trout (Oncorhynchus mykiss) Recombinant is biologically active in PDF-P1 3B9 cells stable transfected with rabbit GH receptors, though its activity is about 10 fold lower than that of human GH.
Rainbow Trout
Untagged
The protein was lyophilized from a concentrated (1 mg/ml) solution with 0.5% NaHCO3. Adjusted to pH 8.
Videos
Documentos