enQuireBio™ Recombinant Rainbow Trout GH Protein

A cDNA sequence encoding the GH was constructed and used to recombinantly synthesize the protein.

Marca: enQuireBio™ QP10630-2ug

Código de producto. 15934468

Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Especificaciones

Nombre	GH Protein
Estado normativo	Research Use Only
Actividad biológica	Somatotropin Rainbow Trout (Oncorhynchus mykiss) Recombinant is biologically active in PDF-P1 3B9 cells stable transfected with rabbit GH receptors, though its activity is about 10 fold lower than that of human GH.
Reactividad cruzada	Rainbow Trout
Etiqueta de proteína	Untagged
Tampón	The protein was lyophilized from a concentrated (1 mg/ml) solution with 0.5% NaHCO3. Adjusted to pH 8.

Cantidad	2 μg
Concentración de endotoxinas	< 1.0 EU per ug protein as determined by the LAL method.
Tipo de producto	Recombinant Protein
Especie	E. coli
Secuencia	AIENQRLFNIAVSRVQHLHLLAQKMFNDFDGTLLPDERRQLNKIFLLDFCNSDSIVSPVDKHETQKSSVLKLLHISFRLIESWEYPSQTLIISNSLMVRNANQISEKLSDLKVGINLLITGSQDGVLSLDDNDSQQLPPYGNYYQNLGGDGNVRRNYELLACFKKDMHKVETYLTVAKCRKSLEANCTL
Grado de pureza o calidad	Greater than 95.0% as determined by:(a) Analysis by SEC-HPLC. (b) Analysis by SDS-PAGE.

Sugerencias de productos

Descripción