enQuireBio™ Recombinant Rainbow Trout GH Protein

A cDNA sequence encoding the GH was constructed and used to recombinantly synthesize the protein.

137.00€ - 5450.00€

Nombre	GH Protein
Estado normativo	Research Use Only
Concentración de endotoxinas	< 1.0 EU per ug protein as determined by the LAL method.
Actividad biológica	Somatotropin Rainbow Trout (Oncorhynchus mykiss) Recombinant is biologically active in PDF-P1 3B9 cells stable transfected with rabbit GH receptors, though its activity is about 10 fold lower than that of human GH.
Tipo de producto	Recombinant Protein

Ver más especificaciones

Productos 3

Código de producto	Marca	Cantidad	Precio	Cantidad y disponibilidad
Código de producto	Marca	Cantidad	Precio	Cantidad y disponibilidad
15934468 Ver documentos Detalles de la promoción missing translation for 'viewProductCertificates'	enQuireBio™ QP10630-2UG	2 μg	137.00€ 2 microgramos Ver productos alternativos Ahorre hasta »	Fecha estimada de envío: Inicie sesión para ver el stock	Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

15914468 Ver documentos Detalles de la promoción missing translation for 'viewProductCertificates'	enQuireBio™ QP10630-10UG	10 μg	212.00€ 10 microgramos Ver productos alternativos Ahorre hasta »	Fecha estimada de envío: Inicie sesión para ver el stock	Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

15924468 Ver documentos Detalles de la promoción missing translation for 'viewProductCertificates'	enQuireBio™ QP10630-1MG	1 mg	5450.00€ 1 miligramo Ver productos alternativos Ahorre hasta »	Fecha estimada de envío: Inicie sesión para ver el stock	Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Especificaciones

Nombre	GH Protein
Concentración de endotoxinas	< 1.0 EU per ug protein as determined by the LAL method.
Tipo de producto	Recombinant Protein
Especie	E. coli
Secuencia	AIENQRLFNIAVSRVQHLHLLAQKMFNDFDGTLLPDERRQLNKIFLLDFCNSDSIVSPVDKHETQKSSVLKLLHISFRLIESWEYPSQTLIISNSLMVRNANQISEKLSDLKVGINLLITGSQDGVLSLDDNDSQQLPPYGNYYQNLGGDGNVRRNYELLACFKKDMHKVETYLTVAKCRKSLEANCTL
Grado de pureza o calidad	Greater than 95.0% as determined by:(a) Analysis by SEC-HPLC. (b) Analysis by SDS-PAGE.

Estado normativo	Research Use Only
Actividad biológica	Somatotropin Rainbow Trout (Oncorhynchus mykiss) Recombinant is biologically active in PDF-P1 3B9 cells stable transfected with rabbit GH receptors, though its activity is about 10 fold lower than that of human GH.
Reactividad cruzada	Rainbow Trout
Etiqueta de proteína	Untagged
Tampón	The protein was lyophilized from a concentrated (1 mg/ml) solution with 0.5% NaHCO3. Adjusted to pH 8.

Descripción