missing translation for 'onlineSavingsMsg'
Learn More

enQuireBio™ Recombinant Mouse IL 17 A/F Protein

A cDNA sequence encoding the IL 17 A/F was constructed and used to recombinantly synthesize the protein.

Marca:  enQuireBio™ QP12392-2ug

Detalles adicionales : Peso : 0.01000kg

 Ver más versiones de este producto

Código de producto. 15970269

  • 120.00€ / 2 microgramos
Fecha estimada de envío: 23-03-2023
para ver el stock

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.


Descripción

Descripción

Especificaciones

Especificaciones

IL 17 A/F Protein
2 μg
Not Determined. Testing recommended prior to use in cell culture and can be performed upon request.
Mouse
Untagged
Lyophilized from a concentrated (1 mg/ml) solution containing no additives.
Greater than 97.0% as determined by SDS-PAGE.
Research Use Only
Recombinant Protein
E. coli
RKNPKAGVPALQKAGNCPPLEDNTVRVDIRIFNQNQGISVPREFQNRSSSPWDYNITRDPHRFPSEIAEAQCRHSGCINAQGQEDSTMNSVAIQQEILVLRREPQGCSNSFRLEKMLLKVGCTCVKPIVHQAAAAIIPQSSACPNTEAKDFLQNVKVNLKVFNSLGAKVSSRRPSDYLNRSTSPWTLHRNEDPDRYPSVIWEAQCRHQRCVNAEGKLDHHMNSVLIQQEILVLKREPESCPFTFRVEKMLVGVGCTCVASIVRQAA
Videos
SDS
Documentos

Documentos

Certificados
Ofertas especiales

Ofertas especiales