missing translation for 'onlineSavingsMsg'
Learn More
Learn More
enQuireBio™ Recombinant Human MOG Protein
A cDNA sequence encoding the MOG was constructed and used to recombinantly synthesize the protein.
Marca: enQuireBio™ QP12718-50ug
Detalles adicionales : Peso : 0.01000kg
Especificaciones
MOG Protein | |
Research Use Only | |
Recombinant Protein | |
E. coli | |
MGQFRVIGPRHPIRALVGDEVELPCRISPGKNATGMEVGWYRPPFSRVVHLYRNGKDQDGDQAPEYRGRTELLKDAIGEGKVTLRIRNVRFSDEGGFTCFFRDHSYQEEAAMELKVEDPFYWVSPGHHHHHH | |
Greater than 95.0% as determined by:(a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE. |
50 μg | |
Not Determined. Testing recommended prior to use in cell culture and can be performed upon request. | |
Human | |
His | |
The Myelin Oligodendrocyte Glycoprotein 0.5 mg/ml solution was lyophilized from 20mM sodium acetate buffer pH 4 and 0.3M sodium chloride. |