missing translation for 'onlineSavingsMsg'
Learn More
Learn More
enQuireBio™ Recombinant Human LR3 IGF1 Protein
A cDNA sequence encoding the LR3 IGF1 was constructed and used to recombinantly synthesize the protein.
Marca: enQuireBio™ QP10775-200ug
Este artículo no se puede devolver.
Vea la política de devoluciones
Especificaciones
LR3 IGF1 Protein | |
Research Use Only | |
The ED50 as determined by the stimulation of protein synthesis in L6 myoblasts is less than 10ng/ml, corresponding to a specific activity of 100,000units/mg. | |
Human | |
Untagged | |
Lyophilized from a 0.2microm filtered concentrated solution in 1xPBS. |
200 μg | |
< 1.0 EU per ug protein as determined by the LAL method. | |
Recombinant Protein | |
E. coli | |
MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIV DECCFRSCDLRRLEMYCAPLKPAKSA | |
Greater than 95.0% as determined by SDS-PAGE and HPLC. |