enQuireBio™ Recombinant HSV HSV-2 gB Protein

Name: enQuireBio&trade; Recombinant HSV HSV-2 gB Protein
Brand: enQuireBio&trade;
SKU: 15940119
Price: 1815.00 EUR

A cDNA sequence encoding the HSV-2 gB was constructed and used to recombinantly synthesize the protein.

Marca: enQuireBio™ QP12342-1mg

Detalles adicionales : Peso : 0.01000kg

Código de producto. 15940119

Fecha estimada de envío: 01-07-2024
para ver el stock

Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Especificaciones

Nombre	HSV HSV-2 gB Protein
Estado normativo	Research Use Only
Tipo de producto	Recombinant Protein
Especie	E. coli
Secuencia	MIAPYKFKATMYYKDVTVSQVWFGHRYSQFMGIFEDRAPVPFEEVIDKINAKGVCRST AKYVRNNLETTAFHRDDHETDMELKPANAATRTSRGWHTTDLKYNPSRVEAFHRYGTTVNCIVEEVDARSVYPYDEFVLATGDFVYMSPFYGYREGSHTEHTSYAADRFKQVDGFYARDLTTKARATAPTTRNLLTTPKFTVAWDWVPKRPSVCTHHHHHH
Grado de pureza o calidad	Protein is >90% pure as determined by SDS PAGE.

Cantidad	1 mg
Concentración de endotoxinas	Not Determined. Testing recommended prior to use in cell culture and can be performed upon request.
Reactividad cruzada	HSV
Etiqueta de proteína	His
Tampón	10mM Phosphate buffer pH 7.6 and 75mM NaCl.

Sugerencias de productos

Descripción