missing translation for 'onlineSavingsMsg'
Learn More

enQuireBio™ Recombinant HPV HPV 18 Protein

A cDNA sequence encoding the HPV 18 was constructed and used to recombinantly synthesize the protein.

Marca:  enQuireBio™ QP12308-500ug

Detalles adicionales : Peso : 0.01000kg

 Ver más versiones de este producto

Código de producto. 15940009

  • 800.00€ / 500 microgramos
Fecha estimada de envío: 27-01-2023
para ver el stock

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.


Descripción

Descripción

Especificaciones

Especificaciones

HPV HPV 18 Protein
500 μg
Not Determined. Testing recommended prior to use in cell culture and can be performed upon request.
HPV
GST
Recombinant HPV-18 solution in PBS, 3M Urea and 0.02% sodium azide as preservative.
Protein is >90% pure as determined by 10% PAGE (Coomassie staining).
Research Use Only
Recombinant Protein
E. coli
VDVYLPPPSVARVVNTDDYVTPTSIFYHAGSSRLLTVGNPYFRVPAGGGNKQDIPKVSAYQYRVFRVQLPDPNKFGLPDTSIYNPETQRLVWACAGVEIGRGQPLGVGLSGHPFYNKLDDTESSHAATSNVSEDVRDNVSVDYKQTQLCILGCAPAIGEHWAKGTACKSRPLSQGDCPPLELKNTVLEDGDMVDTGYGAMDFSTLQDTKCEVPLDICQSICKYPDYLQMSADPYGDSMFFCLRREQLFARHFWNRAGTMGDTVPQSLYIKGTGMPASPGSCVYSPSPSGSIVTSDSQLFNKPYWLHKAQGHNNGVCWHNQLFVTVVDTTPSTNLTICASTQSPVPGQYDATKFKQYSRHVEEYDLQFIFQLCTITLTADVMSYIHSMNSSILEDWNFGVPPPPTTSLVDTYRFVQSVAITCQKDAAPAENKDPYDKLKFWNVDLKEKFSLDLDQYPLGRKFLVQAGLRRKPTIGPRKRSAPSATTSSKPA
Videos
SDS
Documentos
Certificados
Ofertas especiales

Ofertas especiales