missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ MT1F (Human) Recombinant Protein
Human MT1F full-length ORF ( AAH29453, 1 a.a. - 61 a.a.) recombinant protein with GST-tag at N-terminal.
Marca: Abnova™ H00004494-P01.25ug
Detalles adicionales : Peso : 0.00010kg
Descripción
- Sequence: MDPNCSCAAGVSCTCAGSCKCKECKCTSCKKSCCSCCPVGCSKCAQGCVCKGASEKCSCCD
Especificaciones
| AAH29453 | |
| metallothionein 1F | |
| 125% SDS-PAGE Stained with Coomassie Blue | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| MT1F | |
| GST |
| 4494 | |
| Wheat germ expression system | |
| 25 μg | |
| MGC32732, MT1 | |
| Wheat Germ (in vitro) | |
| 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer |