missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human ZNF134 Partial ORF (NP_003426.2, 105 a.a. - 193 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Marca: Abnova™ H00007693-Q01.25ug
Detalles adicionales : Peso : 0.00010kg
Descripción
Sequence: PLRRDKSEASIVRNCTVSKEPHPSEKPFTCKEEQKNFQATLGGCQQKAIHSKRKTHRSTESGDAFHGEQMHYKCSECGKAFSRKDTLVQEspecificaciones
NP_003426.2 | |
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
35.53kDa | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
PLRRDKSEASIVRNCTVSKEPHPSEKPFTCKEEQKNFQATLGGCQQKAIHSKRKTHRSTESGDAFHGEQMHYKCSECGKAFSRKDTLVQ | |
RUO | |
ZNF134 | |
Wheat Germ (in vitro) | |
GST | |
Liquid |
Antibody Production, Protein Array, ELISA, Western Blot | |
7693 | |
ZNF134 (Human) Recombinant Protein (Q01) | |
25 ug | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
MGC138499/MGC141970/pHZ-15 | |
ZNF134 | |
Recombinant | |
wheat germ expression system |