Learn More
Abnova™ Human WSB1 Partial ORF (AAH21110.1, 53 a.a. - 137 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Marca: Abnova™ H00026118-Q02.10ug
Detalles adicionales : Peso : 0.02000kg
Descripción
This gene encodes a member of the WD-protein subfamily. This protein shares a high sequence identity to mouse and chick proteins. It contains several WD-repeats spanning most of the protein and an SOCS box in the C-terminus. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq]
Sequence: QGHRTVKLVPWSQCLQNFLLHGTKNVTNSSSLRLPRQNSDGGQKNKPREHIIDCGDIVWSLAFGSSVPEKQSRCVNIEWHRFRFGEspecificaciones
AAH21110.1 | |
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
35.09kDa | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
QGHRTVKLVPWSQCLQNFLLHGTKNVTNSSSLRLPRQNSDGGQKNKPREHIIDCGDIVWSLAFGSSVPEKQSRCVNIEWHRFRFG | |
RUO | |
WSB1 | |
Wheat Germ (in vitro) | |
GST | |
Liquid |
Antibody Production, ELISA, Protein Array, Western Blot | |
26118 | |
WSB1 (Human) Recombinant Protein (Q02) | |
10 ug | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
SWIP1/WSB-1 | |
WSB1 | |
Recombinant | |
wheat germ expression system |