missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human WBSCR27 Full-length ORF (AAH30295.1, 1 a.a. - 245 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marca:  Abnova™ H00155368-P01.10ug

Detalles adicionales : Peso : 0.00010kg

 Ver más versiones de este producto

Código de producto. 16168813

  • 335.00€ / 10 microgramos
Fecha estimada de envío: 25-06-2024
para ver el stock

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.


Descripción

Descripción

This gene encodes a protein belonging to ubiE/COQ5 methyltransferase family. The gene is deleted in Williams syndrome, a multisystem developmental disorder caused by the deletion of contiguous genes at 7q11.22-q11.23. [provided by RefSeq]

Sequence: MAQEEGGSLPEVRARVRAAHGIPDLAQKLHFYDRWAPDYDQDVATLLYRAPRLAVDCLTQALPGPPHSALILDVACGTGLVAAELRAPGFLQLHGVDGSPGMLEQARAPGLYQRLSLCTLGQEPLPSPEGTFDAVLIVGALSDGQVPCNAIPELHVTKPGGLVCLTTRTNWSNLQYKEALEATLDRLEQAGMWEGLVAWPVDRLWTAGSWLPPSWWWYPASLPRMASSPALSTCTESGRRPRLRK
Especificaciones

Especificaciones

AAH30295.1
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
53.1kDa
Glutathione Sepharose 4 Fast Flow
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
MGC40131
WBSCR27
Recombinant
wheat germ expression system
Antibody Production, ELISA, Protein Array, Western Blot
155368
WBSCR27 (Human) Recombinant Protein (P01)
12.5% SDS-PAGE Stained with Coomassie Blue.
MAQEEGGSLPEVRARVRAAHGIPDLAQKLHFYDRWAPDYDQDVATLLYRAPRLAVDCLTQALPGPPHSALILDVACGTGLVAAELRAPGFLQLHGVDGSPGMLEQARAPGLYQRLSLCTLGQEPLPSPEGTFDAVLIVGALSDGQVPCNAIPELHVTKPGGLVCLTTRTNWSNLQYKEALEATLDRLEQAGMWEGLVAWPVDRLWTAGSWLPPSWWWYPASLPRMASSPALSTCTESGRRPRLRK
RUO
WBSCR27
Wheat Germ (in vitro)
GST
Liquid
Sugerencias de productos

Sugerencias de productos

Videos
SDS
Documentos

Documentos

Certificados
Ofertas especiales

Ofertas especiales