missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human WBSCR27 Full-length ORF (AAH30295.1, 1 a.a. - 245 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

335.00€ - 508.00€

Especificaciones

Número de acceso AAH30295.1
Para utilizar con (aplicación) Antibody Production, ELISA, Protein Array, Western Blot
Formulación 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
ID de gen (Entrez) 155368
Peso molecular 53.1kDa
Ver más especificaciones

Productos 2
Código de producto Marca Cantidad Precio Cantidad y disponibilidad  
Código de producto Marca Cantidad Precio Cantidad y disponibilidad  
16178813
Ver documentos Detalles de la promoción
Abnova™
H00155368-P01.25UG
25 ug
508.00€
25 microgramos
Ver productos alternativos
Ahorre hasta 
»
Fecha estimada de envío: 17-07-2024
para ver el stock
Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.
16168813
Ver documentos Detalles de la promoción
Abnova™
H00155368-P01.10UG
10 ug
335.00€
10 microgramos
Ver productos alternativos
Ahorre hasta 
»
Fecha estimada de envío: 17-07-2024
para ver el stock
Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.
Descripción

Descripción

This gene encodes a protein belonging to ubiE/COQ5 methyltransferase family. The gene is deleted in Williams syndrome, a multisystem developmental disorder caused by the deletion of contiguous genes at 7q11.22-q11.23. [provided by RefSeq]

Sequence: MAQEEGGSLPEVRARVRAAHGIPDLAQKLHFYDRWAPDYDQDVATLLYRAPRLAVDCLTQALPGPPHSALILDVACGTGLVAAELRAPGFLQLHGVDGSPGMLEQARAPGLYQRLSLCTLGQEPLPSPEGTFDAVLIVGALSDGQVPCNAIPELHVTKPGGLVCLTTRTNWSNLQYKEALEATLDRLEQAGMWEGLVAWPVDRLWTAGSWLPPSWWWYPASLPRMASSPALSTCTESGRRPRLRK
Especificaciones

Especificaciones

AAH30295.1
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
53.1kDa
Glutathione Sepharose 4 Fast Flow
MAQEEGGSLPEVRARVRAAHGIPDLAQKLHFYDRWAPDYDQDVATLLYRAPRLAVDCLTQALPGPPHSALILDVACGTGLVAAELRAPGFLQLHGVDGSPGMLEQARAPGLYQRLSLCTLGQEPLPSPEGTFDAVLIVGALSDGQVPCNAIPELHVTKPGGLVCLTTRTNWSNLQYKEALEATLDRLEQAGMWEGLVAWPVDRLWTAGSWLPPSWWWYPASLPRMASSPALSTCTESGRRPRLRK
RUO
WBSCR27
Wheat Germ (in vitro)
GST
Liquid
Antibody Production, ELISA, Protein Array, Western Blot
155368
WBSCR27 (Human) Recombinant Protein (P01)
12.5% SDS-PAGE Stained with Coomassie Blue.
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
MGC40131
WBSCR27
Recombinant
wheat germ expression system
Videos
SDS
Documentos

Documentos

Product Certifications