Learn More
Abnova™ Human UCHL1 Partial ORF (NP_004172, 101 a.a. - 190 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Marca: Abnova™ H00007345-Q02.25ug
Detalles adicionales : Peso : 0.02000kg
Descripción
The protein encoded by this gene belongs to the peptidase C12 family. This enzyme is a thiol protease that hydrolyzes a peptide bond at the C-terminal glycine of ubiquitin. This gene is specifically expressed in the neurons and in cells of the diffuse neuroendocrine system. Mutations in this gene may be associated with Parkinson disease
Sequence: NNQDKLGFEDGSVLKQFLSETEKMSPEDRAKCFEKNEAIQAAHDAVAQEGQCRVDDKVNFHFILFNNVDGHLYELDGRMPFPVNHGASSEEspecificaciones
NP_004172 | |
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
35.64kDa | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
NNQDKLGFEDGSVLKQFLSETEKMSPEDRAKCFEKNEAIQAAHDAVAQEGQCRVDDKVNFHFILFNNVDGHLYELDGRMPFPVNHGASSE | |
RUO | |
UCHL1 | |
Wheat Germ (in vitro) | |
GST | |
Liquid |
Antibody Production, ELISA, Protein Array, Western Blot | |
7345 | |
UCHL1 (Human) Recombinant Protein (Q02) | |
25 ug | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
PARK5/PGP9.5/Uch-L1 | |
UCHL1 | |
Recombinant | |
wheat germ expression system |