missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human UBASH3A Partial ORF (NP_001001895, 524 a.a. - 623 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Marca: Abnova™ H00053347-Q01.25ug
Detalles adicionales : Peso : 0.00010kg
Descripción
Sequence: MDRCTASMVQIVNTCPQDTGVILIVSHGSTLDSCTRPLLGLPPRECGDFAQLVRKIPSLGMCFCEENKEEGKWELVNPPVKTLTHGANAAFNWRNWISGNEspecificaciones
| NP_001001895 | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 36.74kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| MDRCTASMVQIVNTCPQDTGVILIVSHGSTLDSCTRPLLGLPPRECGDFAQLVRKIPSLGMCFCEENKEEGKWELVNPPVKTLTHGANAAFNWRNWISGN | |
| RUO | |
| UBASH3A | |
| Wheat Germ (in vitro) | |
| GST | |
| Liquid |
| Antibody Production, ELISA, Protein Array, Western Blot | |
| 53347 | |
| UBASH3A (Human) Recombinant Protein (Q01) | |
| 25 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| CLIP4/STS-2/TULA | |
| UBASH3A | |
| Recombinant | |
| wheat germ expression system |