missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human TXNDC3 Partial ORF (NP_057700, 530 a.a. - 586 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Marca: Abnova™ H00051314-Q01.25ug
Detalles adicionales : Peso : 0.00010kg
Descripción
TXNDC3 encodes a group II thioredoxin protein, composed of a thioredoxin domain and 3 NDP kinase domains, with testis-specific expression.[supplied by OMIM]
Sequence: AEWRRLMGPTDPEEAKLLSPDSIRAQFGISKLKNIVHGASNAYEAKEVVNRLFEDPEEspecificaciones
NP_057700 | |
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
32.01kDa | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
AEWRRLMGPTDPEEAKLLSPDSIRAQFGISKLKNIVHGASNAYEAKEVVNRLFEDPE | |
RUO | |
TXNDC3 | |
Wheat Germ (in vitro) | |
GST | |
Liquid |
Antibody Production, ELISA, Protein Array, Western Blot | |
51314 | |
TXNDC3 (Human) Recombinant Protein (Q01) | |
25 ug | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
CILD6/NME8/SPTRX2 | |
TXNDC3 | |
Recombinant | |
wheat germ expression system |