missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human TMSB4Y Full-length ORF (NP_004193.1, 1 a.a. - 44 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
en la oferta
Especificaciones
Número de acceso | NP_004193.1 |
---|---|
Para utilizar con (aplicación) | Antibody Production, Protein Array, ELISA, Western Blot |
Formulación | 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. |
ID de gen (Entrez) | 9087 |
Peso molecular | 31.4kDa |
Código de producto | Marca | Cantidad | Precio | Cantidad y disponibilidad | |||||
---|---|---|---|---|---|---|---|---|---|
Código de producto | Marca | Cantidad | Precio | Cantidad y disponibilidad | |||||
16113272
|
Abnova™
H00009087-P01.25UG |
25 ug |
en la oferta
25 microgramos |
N/A | Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo. | ||||
Este artículo requiere una actualización de precios antes de ser solicitado. Solicite el precio de este artículo aquí. |
|||||||||
16103272
|
Abnova™
H00009087-P01.10UG |
10 ug |
en la oferta
10 microgramos |
N/A | Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo. | ||||
Este artículo requiere una actualización de precios antes de ser solicitado. Solicite el precio de este artículo aquí. |
|||||||||
Descripción
This gene lies within the male specific region of chromosome Y. Its homolog on chromosome X escapes X inactivation and encodes an actin sequestering protein. [provided by RefSeq]
Sequence: MSDKPGMAEIEKFDKSKLKKTETQEKNPLSSKETIEQERQAGESEspecificaciones
NP_004193.1 | |
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
31.4kDa | |
Glutathione Sepharose 4 Fast Flow | |
MSDKPGMAEIEKFDKSKLKKTETQEKNPLSSKETIEQERQAGES | |
RUO | |
TMSB4Y | |
Wheat Germ (in vitro) | |
GST | |
Liquid |
Antibody Production, Protein Array, ELISA, Western Blot | |
9087 | |
TMSB4Y (Human) Recombinant Protein (P01) | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
MGC26307/TB4Y | |
TMSB4Y | |
Recombinant | |
wheat germ expression system |