Learn More
Abnova™ Human TMSB4Y Full-length ORF (NP_004193.1, 1 a.a. - 44 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Marca: Abnova™ H00009087-P01.10ug
Detalles adicionales : Peso : 0.00010kg
Descripción
This gene lies within the male specific region of chromosome Y. Its homolog on chromosome X escapes X inactivation and encodes an actin sequestering protein. [provided by RefSeq]
Sequence: MSDKPGMAEIEKFDKSKLKKTETQEKNPLSSKETIEQERQAGESEspecificaciones
NP_004193.1 | |
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
31.4kDa | |
Glutathione Sepharose 4 Fast Flow | |
10 ug | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
MGC26307/TB4Y | |
TMSB4Y | |
Recombinant | |
wheat germ expression system |
Antibody Production, Protein Array, ELISA, Western Blot | |
9087 | |
TMSB4Y (Human) Recombinant Protein (P01) | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
MSDKPGMAEIEKFDKSKLKKTETQEKNPLSSKETIEQERQAGES | |
RUO | |
TMSB4Y | |
Wheat Germ (in vitro) | |
GST | |
Liquid |