missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human TIMP4 Full-length ORF (AAH10553.1, 1 a.a. - 224 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Marca: Abnova™ H00007079-P01.10ug
Este artículo no se puede devolver.
Vea la política de devoluciones
Descripción
This gene belongs to the TIMP gene family. The proteins encoded by this gene family are inhibitors of the matrix metalloproteinases, a group of peptidases involved in degradation of the extracellular matrix. The secreted, netrin domain-containing protein encoded by this gene is involved in regulation of platelet aggregation and recruitment and may play role in hormonal regulation and endometrial tissue remodeling. [provided by RefSeq]
Sequence: MPGSPRPAPSWVLLLRLLALLRPPGLGEACSCAPAHPQQHICHSALVIRAKISSEKVVPASADPADTEKMLRYEIKQIKMFKGFEKVKDVQYIYTPFDSSLCGVKLEANSQKQYLLTGQVLSDGKVFIHLCNYIEPWEGLSLVQRESLNHHYHLNCGCQITTCYTVPCTISAPNECLWTDWLLGRKLYGYQAQHYVCMKHVDGTCSWYRGHLPLRKEFVDIVQPEspecificaciones
AAH10553.1 | |
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
50.38kDa | |
Glutathione Sepharose 4 Fast Flow | |
10 ug | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
TIMP4 | |
Wheat Germ (in vitro) | |
GST | |
Liquid |
Antibody Production, Protein Array, ELISA, Western Blot | |
7079 | |
TIMP4 (Human) Recombinant Protein (P01) | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
MPGSPRPAPSWVLLLRLLALLRPPGLGEACSCAPAHPQQHICHSALVIRAKISSEKVVPASADPADTEKMLRYEIKQIKMFKGFEKVKDVQYIYTPFDSSLCGVKLEANSQKQYLLTGQVLSDGKVFIHLCNYIEPWEGLSLVQRESLNHHYHLNCGCQITTCYTVPCTISAPNECLWTDWLLGRKLYGYQAQHYVCMKHVDGTCSWYRGHLPLRKEFVDIVQP | |
RUO | |
TIMP4 | |
Recombinant | |
wheat germ expression system |