missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human SRD5A2 Partial ORF (NP_000339.2, 28 a.a. - 65 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marca:  Abnova™ H00006716-Q01.25ug

Detalles adicionales : Peso : 0.02000kg

 Ver más versiones de este producto

Código de producto. 16064765

  • 545.00€ / 25 microgramos
Fecha estimada de envío: 23-08-2022
para ver el stock

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.


Descripción

Descripción

This gene encodes a microsomal protein expressed at high levels in androgen-sensitive tissues such as the prostate. The encoded protein is active at acidic pH and is sensitive to the 4-azasteroid inhibitor finasteride. Deficiencies in this gene can result in male pseudohermaphroditism, specifically pseudovaginal perineoscrotal hypospadias (PPSH). [provided by RefSeq]

Sequence: AKPSGYGKHTESLKPAATRLPARAAWFLQELPSFAVPA
Especificaciones

Especificaciones

NP_000339.2
Liquid
6716
SRD5A2 (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
MGC138457
SRD5A2
Yes
wheat germ expression system
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
29.81kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
AKPSGYGKHTESLKPAATRLPARAAWFLQELPSFAVPA
RUO
SRD5A2
Wheat Germ (in vitro)
GST
Videos
SDS
Documentos
Certificados
Ofertas especiales

Ofertas especiales