missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human SPRED2 Partial ORF (NP_861449, 120 a.a. - 219 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Marca: Abnova™ H00200734-Q01.25ug
Detalles adicionales : Peso : 0.00010kg
Descripción
SPRED2 is a member of the Sprouty (see SPRY1; MIM 602465)/SPRED family of proteins that regulate growth factor-induced activation of the MAP kinase cascade (see MAPK1; MIM 176948) (Nonami et al., 2004 [PubMed 15465815]).[supplied by OMIM]
Sequence: EDLIEGSTTSSSTIHNEAELGDDDVFTTATDSSSNSSQKREQPTRTISSPTSCEHRRIYTLGHLHDSYPTDHYHLDQPMPRPCRQVSFPDDDEEIVRINPEspecificaciones
| NP_861449 | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 36.74kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| EDLIEGSTTSSSTIHNEAELGDDDVFTTATDSSSNSSQKREQPTRTISSPTSCEHRRIYTLGHLHDSYPTDHYHLDQPMPRPCRQVSFPDDDEEIVRINP | |
| RUO | |
| SPRED2 | |
| Wheat Germ (in vitro) | |
| GST | |
| Liquid |
| Antibody Production, ELISA, Protein Array, Western Blot | |
| 200734 | |
| SPRED2 (Human) Recombinant Protein (Q01) | |
| 25 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| FLJ21897/FLJ31917/MGC163164/Spred-2 | |
| SPRED2 | |
| Recombinant | |
| wheat germ expression system |