missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human SMAD6 Partial ORF (NP_005576, 285 a.a. - 384 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

359.00€ - 545.00€

Especificaciones

Nombre SMAD6 (Human) Recombinant Protein (Q01)
Recombinante Yes
Para utilizar con (aplicación) Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
Peso molecular 36.74kDa
Requisitos de almacenamiento Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Ver más especificaciones

Productos 2
Código de producto Marca Cantidad Precio Cantidad y disponibilidad  
Código de producto Marca Cantidad Precio Cantidad y disponibilidad  
16024365
Ver documentos Detalles de la promoción
Abnova™
H00004091-Q01.25UG
25 ug
545.00€
25 microgramos
Ver productos alternativos
Ahorre hasta 
»
Fecha estimada de envío: 17-08-2022
para ver el stock
Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.
16014365
Ver documentos Detalles de la promoción
Abnova™
H00004091-Q01.10UG
10 ug
359.00€
10 microgramos
Ver productos alternativos
Ahorre hasta 
»
Fecha estimada de envío: 17-08-2022
para ver el stock
Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.
Descripción

Descripción

The protein encoded by this gene belongs to the SMAD family of proteins, which are related to Drosophila 'mothers against decapentaplegic' (Mad) and C. elegans Sma. SMAD proteins are signal transducers and transcriptional modulators that mediate multiple signaling pathways. This protein functions in the negative regulation of BMP and TGF-beta/activin-signalling. Multiple transcript variants encoding different isoforms have been found for this gene

Sequence: RDEYKPLDLSDSTLSYTETEATNSLITAPGEFSDASMSPDATKPSHWCSVAYWEHRTRVGRLYAVYDQAVSIFYDLPQGSGFCLGQLNLEQRSESVRRTR
Especificaciones

Especificaciones

SMAD6 (Human) Recombinant Protein (Q01)
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Yes
36.74kDa
SDS
Product Certifications