missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human SMAD3 Partial ORF (NP_005893, 147 a.a. - 270 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marca:  Abnova™ H00004088-Q03.10ug

Detalles adicionales : Peso : 0.00010kg

 Ver más versiones de este producto

Código de producto. 16197521

  • 310.00€ / 10 microgramos


Fecha estimada de envío
12-02-2021
Añadir a la cesta

Descripción

Descripción

Sequence: PAEFPPLDDYSHSIPENTNFPAGIEPQSNIPETPPPGYLSEDGETSDHQMNHSMDAGSPNLSPNPMSPAHNNLDLQPVTYCEPAFWCSISYYELNQRVGETFHASQPSMTVDGFTDPSNSERFC
Especificaciones

Especificaciones

NP_005893
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
39.27kDa
12.5% SDS-PAGE Stained with Coomassie Blue
PAEFPPLDDYSHSIPENTNFPAGIEPQSNIPETPPPGYLSEDGETSDHQMNHSMDAGSPNLSPNPMSPAHNNLDLQPVTYCEPAFWCSISYYELNQRVGETFHASQPSMTVDGFTDPSNSERFC
RUO
SMAD3
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
4088
SMAD3 (Human) Recombinant Protein (Q03)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
DKFZp586N0721|DKFZp686J10186|HSPC193|HsT17436|JV15-2|MADH3|MGC60396
SMAD3
Yes
Videos
SDS
Documentos