missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human RXRA Partial ORF (NP_002948.1, 27 a.a. - 94 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marca:  Abnova™ H00006256-Q02.10ug

Detalles adicionales : Peso : 0.02000kg

 Ver más versiones de este producto

Código de producto. 16064705

  • 359.00€ / 10 microgramos
Fecha estimada de envío: 19-08-2022
para ver el stock

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.


Descripción

Descripción

Retinoid X receptors (RXRs) and retinoic acid receptors (RARs), are nuclear receptors that mediate the biological effects of retinoids by their involvement in retinoic acid-mediated gene activation. These receptors exert their action by binding, as homodimers or heterodimers, to specific sequences in the promoters of target genes and regulating their transcription. The protein encoded by this gene is a member of the steroid and thyroid hormone receptor superfamily of transcriptional regulators. [provided by RefSeq]

Sequence: SMAAPSLHPSLGPGIGSPGQLHSPISTLSSPINGMGPPFSVISSPMGPHSMSVPTTPTLGFSTGSPQL
Especificaciones

Especificaciones

NP_002948.1
Liquid
6256
RXRA (Human) Recombinant Protein
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
FLJ00280/FLJ00318/FLJ16020/FLJ16733/MGC102720/NR2B1
RXRA
Yes
wheat germ expression system
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
32.89kDa
12.5% SDS-PAGE Stained with Coomassie Blue
SMAAPSLHPSLGPGIGSPGQLHSPISTLSSPINGMGPPFSVISSPMGPHSMSVPTTPTLGFSTGSPQL
RUO
RXRA
Wheat Germ (in vitro)
GST
Videos
SDS
Documentos
Certificados
Ofertas especiales

Ofertas especiales