missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human RIT1 Partial ORF (NP_008843, 120 a.a. - 217 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Marca: Abnova™ H00006016-Q01.10ug
Detalles adicionales : Peso : 0.00010kg
Descripción
RIT belongs to the RAS (HRAS; MIM 190020) subfamily of small GTPases (Hynds et al., 2003 [PubMed 12668729]).[supplied by OMIM]
Sequence: RVRRTDDTPVVLVGNKSDLKQLRQVTKEEGLALAREFSCPFFETSAAYRYYIDDVFHALVREIRRKEKEAVLAMEKKSKPKNSVWKRLKSPFRKKKDSEspecificaciones
| NP_008843 | |
| Liquid | |
| 6016 | |
| RIT1 (Human) Recombinant Protein (Q01) | |
| 10 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| MGC125864/MGC125865/RIBB/RIT/ROC1 | |
| RIT1 | |
| Yes | |
| wheat germ expression system |
| Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein) | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 36.52kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| RVRRTDDTPVVLVGNKSDLKQLRQVTKEEGLALAREFSCPFFETSAAYRYYIDDVFHALVREIRRKEKEAVLAMEKKSKPKNSVWKRLKSPFRKKKDS | |
| RUO | |
| RIT1 | |
| Wheat Germ (in vitro) | |
| GST |