missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human RGC32 Partial ORF (NP_054778.1, 1 a.a. - 117 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

359.00€ - 545.00€

Especificaciones

Nombre RGC32 (Human) Recombinant Protein (Q02)
Recombinante Yes
Para utilizar con (aplicación) Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
Peso molecular 38.61kDa
Requisitos de almacenamiento Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Ver más especificaciones

Productos 2
Código de producto Marca Cantidad Precio Cantidad y disponibilidad  
Código de producto Marca Cantidad Precio Cantidad y disponibilidad  
16025455
Ver documentos Detalles de la promoción
Abnova™
H00028984-Q02.25UG
25 ug
545.00€
25 microgramos
Ver productos alternativos
Ahorre hasta 
»
Fecha estimada de envío: 24-08-2022
para ver el stock
Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.
16015455
Ver documentos Detalles de la promoción
Abnova™
H00028984-Q02.10UG
10 ug
359.00€
10 microgramos
Ver productos alternativos
Ahorre hasta 
»
Fecha estimada de envío: 24-08-2022
para ver el stock
Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.
Descripción

Descripción

This gene is thought to regulate cell cycle progression. It is induced by p53 in response to DNA damage, or by sublytic levels of complement system proteins that result in activation of the cell cycle. The encoded protein localizes to the cytoplasm during interphase and to centrosomes during mitosis. The protein forms a complex with polo-like kinase 1. The protein also translocates to the nucleus in response to treatment with complement system proteins, and can associate with and increase the kinase activity of cell division cycle 2 protein. In different assays and cell types, overexpression of this protein has been shown to activate or suppress cell cycle progression. [provided by RefSeq]

Sequence: MKPPAEDLSDALCEFDAVLADFASPFHERHFHYEEHLERMKRRSSASVSDSSGFSDSESADSLYRNSFSFSDEKLNSPTDSTPALLSATVTPQKAKLGDTKELEAFIADLDKTLASM
Especificaciones

Especificaciones

RGC32 (Human) Recombinant Protein (Q02)
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Yes
38.61kDa
SDS
Product Certifications