missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human RCVRN Partial ORF (NP_002894.1, 3 a.a. - 99 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marca:  Abnova™ H00005957-Q04.25ug

Detalles adicionales : Peso : 0.02000kg

 Ver más versiones de este producto

Código de producto. 16004675

  • 518.16€ / 25 microgramos
Envío estimado: 10-03-2022

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.


Descripción

Descripción

This gene encodes a member of the recoverin family of neuronal calcium sensors. The encoded protein contains three calcium-binding EF-hand domains and may prolong the termination of the phototransduction cascade in the retina by blocking the phosphorylation of photo-activated rhodopsin. Recoverin may be the antigen responsible for cancer-associated retinopathy. [provided by RefSeq]

Sequence: NSKSGALSKEILEELQLNTKFSEEELCSWYQSFLKDCPTGRITQQQFQSIYAKFFPDTDPKAYAQHVFRSFDSNLDGTLDFKEYVIALHMTTAGKTN
Especificaciones

Especificaciones

NP_002894.1
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.3kDa
12.5% SDS-PAGE Stained with Coomassie Blue
NSKSGALSKEILEELQLNTKFSEEELCSWYQSFLKDCPTGRITQQQFQSIYAKFFPDTDPKAYAQHVFRSFDSNLDGTLDFKEYVIALHMTTAGKTN
RUO
RCVRN
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
5957
RCVRN (Human) Recombinant Protein (Q04)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
RCV1
RCVRN
Yes
Videos
SDS
Documentos
Certificados
Ofertas especiales

Ofertas especiales