Learn More
Abnova™ Human RCVRN Partial ORF (NP_002894.1, 3 a.a. - 99 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Marca: Abnova™ H00005957-Q04.25ug
Detalles adicionales : Peso : 0.02000kg
Descripción
This gene encodes a member of the recoverin family of neuronal calcium sensors. The encoded protein contains three calcium-binding EF-hand domains and may prolong the termination of the phototransduction cascade in the retina by blocking the phosphorylation of photo-activated rhodopsin. Recoverin may be the antigen responsible for cancer-associated retinopathy. [provided by RefSeq]
Sequence: NSKSGALSKEILEELQLNTKFSEEELCSWYQSFLKDCPTGRITQQQFQSIYAKFFPDTDPKAYAQHVFRSFDSNLDGTLDFKEYVIALHMTTAGKTNEspecificaciones
NP_002894.1 | |
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
36.3kDa | |
12.5% SDS-PAGE Stained with Coomassie Blue | |
NSKSGALSKEILEELQLNTKFSEEELCSWYQSFLKDCPTGRITQQQFQSIYAKFFPDTDPKAYAQHVFRSFDSNLDGTLDFKEYVIALHMTTAGKTN | |
RUO | |
RCVRN | |
Wheat Germ (in vitro) | |
GST | |
Liquid |
Antibody Production, ELISA, Protein Array, Western Blot | |
5957 | |
RCVRN (Human) Recombinant Protein (Q04) | |
25 ug | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
RCV1 | |
RCVRN | |
Recombinant | |
wheat germ expression system |