Learn More
Abnova™ Human RCE1 Partial ORF (NP_005124, 133 a.a. - 182 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Marca: Abnova™ H00009986-Q01.10ug
Detalles adicionales : Peso : 0.00010kg
Descripción
This gene encodes an integral membrane protein which is classified as a member of the metalloproteinase family. This enzyme is thought to function in the maintenance and processing of CAAX-type prenylated proteins. [provided by RefSeq]
Sequence: QLSMDCPCDLADGLKVVLAPRSWARCLTDMRWLRNQVIAPLTEELVFRACEspecificaciones
NP_005124 | |
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
31.24kDa | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
QLSMDCPCDLADGLKVVLAPRSWARCLTDMRWLRNQVIAPLTEELVFRAC | |
RUO | |
RCE1 | |
Wheat Germ (in vitro) | |
GST | |
Liquid |
Antibody Production, ELISA, Protein Array, Western Blot | |
9986 | |
RCE1 (Human) Recombinant Protein (Q01) | |
10 ug | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
FACE2/RCE1A/RCE1B | |
RCE1 | |
Recombinant | |
wheat germ expression system |