missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human RARA Partial ORF (NP_000955, 169 a.a. - 235 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

359.00€ - 545.00€

Especificaciones

Nombre RARA (Human) Recombinant Protein (Q02)
Recombinante Yes
Para utilizar con (aplicación) Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
Peso molecular 33kDa
Requisitos de almacenamiento Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Ver más especificaciones

Productos 2
Código de producto Marca Cantidad Precio Cantidad y disponibilidad  
Código de producto Marca Cantidad Precio Cantidad y disponibilidad  
16034645
Ver documentos Detalles de la promoción
Abnova™
H00005914-Q02.10UG
10 ug
359.00€
10 microgramos
Ver productos alternativos
Ahorre hasta 
»
Fecha estimada de envío: 24-08-2022
para ver el stock
Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.
16044645
Ver documentos Detalles de la promoción
Abnova™
H00005914-Q02.25UG
25 ug
545.00€
25 microgramos
Ver productos alternativos
Ahorre hasta 
»
Fecha estimada de envío: 24-08-2022
para ver el stock
Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.
Descripción

Descripción

Retinoid signaling is transduced by 2 families of nuclear receptors, retinoic acid receptor (RAR) and retinoid X receptor (RXR; see MIM 180245), which form RXR/RAR heterodimers. In the absence of ligand, DNA-bound RXR/RARA represses transcription by recruiting the corepressors NCOR1 (MIM 600849), SMRT (NCOR2; MIM 600848), and histone deacetylase (see MIM 601241). When ligand binds to the complex, it induces a conformational change allowing the recruitment of coactivators, histone acetyltransferases (see MIM 603053), and the basic transcription machinery. Translocations that always involve rearrangement of the RARA gene are a cardinal feature of acute promyelocytic leukemia (APL; MIM 612376). The most frequent translocation is t(15,17)(q21;q22), which fuses the RARA gene with the PML gene (MIM 102578) (Vitoux et al., 2007 [PubMed 17468032]).[supplied by OMIM]

Sequence: VPKPECSESYTLTPEVGELIEKVRKAHQETFPALCQLGKYTTNNSSEQRVSLDIDLWDKFSELSTKC
Especificaciones

Especificaciones

RARA (Human) Recombinant Protein (Q02)
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Yes
33kDa
SDS
Product Certifications