missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human RAB42 Full-length ORF (NP_689517.1, 1 a.a. - 105 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marca:  Abnova™ H00115273-P01.10ug

Detalles adicionales : Peso : 0.00010kg

 Ver más versiones de este producto

Código de producto. 16167203

  • 335.00€ / 10 microgramos
Fecha estimada de envío: 20-08-2024
para ver el stock

Descripción

Descripción

Sequence: MATQGPDKVIFLLVGHKSDLQSTRCVSAQEAEELAASLGMAFVETSVKNNCNVDLAFDTLADAIQQALQQGDIKLEEGWGGVRLIHKTQIPRSPSRKQHSGPCQC
Especificaciones

Especificaciones

NP_689517.1
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
37.8kDa
Glutathione Sepharose 4 Fast Flow
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
MGC45806/RP4-669K10.6
RAB42
Recombinant
wheat germ expression system
Antibody Production, Protein Array, ELISA, Western Blot
115273
RAB42 (Human) Recombinant Protein (P01)
12.5% SDS-PAGE Stained with Coomassie Blue.
MATQGPDKVIFLLVGHKSDLQSTRCVSAQEAEELAASLGMAFVETSVKNNCNVDLAFDTLADAIQQALQQGDIKLEEGWGGVRLIHKTQIPRSPSRKQHSGPCQC
RUO
RAB42
Wheat Germ (in vitro)
GST
Liquid
Sugerencias de productos

Sugerencias de productos

Videos
SDS
Documentos

Documentos

Certificados
Ofertas especiales

Ofertas especiales