Learn More
Abnova™ Human RAB34 Partial ORF (NP_114140.2, 170 a.a. - 259 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Marca: Abnova™ H00083871-Q01.10ug
Detalles adicionales : Peso : 0.00010kg
Descripción
RAB proteins, like RAB34, are small GTPases that regulate vesicle budding, docking, and fusion along endocytosis and exocytosis pathways (Chen et al., 2003 [PubMed 12684051]).[supplied by OMIM]
Sequence: LSTPAQYALMEKDALQVAQEMKAEYWAVSSLTGENVREFFFRVAALTFEANVLAELEKSGARRIGDVVRINSDDSNLYLTASKKKPTCCPEspecificaciones
NP_114140.2 | |
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
35.64kDa | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
LSTPAQYALMEKDALQVAQEMKAEYWAVSSLTGENVREFFFRVAALTFEANVLAELEKSGARRIGDVVRINSDDSNLYLTASKKKPTCCP | |
RUO | |
RAB34 | |
Wheat Germ (in vitro) | |
GST | |
Liquid |
Antibody Production, ELISA, Protein Array, Western Blot | |
83871 | |
RAB34 (Human) Recombinant Protein (Q01) | |
10 ug | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
RAB39/RAH | |
RAB34 | |
Recombinant | |
wheat germ expression system |