missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human PAX5 Partial ORF (NP_057953, 192 a.a. - 301 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marke:  Abnova™ H00005079-Q01.25ug

Weitere Details : Peso : 0.00010kg

 Weitere Artikel aus diesem Sortiment

Artikelnummer. 16192385

  • 467.00€ / 25 microgramos


Fecha estimada de envío
15-02-2021
Zum Warenkorb hinzufügen

Beschreibung

Beschreibung

Sequence: ADTNKRKRDEGIQESPVPNGHSLPGRDFLRKQMRGDLFTQQQLEVLDRVFERQHYSDIFTTTEPIKPEQTTEYSAMASLAGGLDDMKANLASPTPADIGSSVPGPQSYPI
Spezifikation

Spezifikation

NP_057953
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
37.84kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
ADTNKRKRDEGIQESPVPNGHSLPGRDFLRKQMRGDLFTQQQLEVLDRVFERQHYSDIFTTTEPIKPEQTTEYSAMASLAGGLDDMKANLASPTPADIGSSVPGPQSYPI
RUO
PAX5
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
5079
PAX5 (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
BSAP
PAX5
Yes
Videos
Sicherheitsdatenblatt (SDS)
Dokumentation