missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human PAN3 Partial ORF (NP_787050, 508 a.a. - 615 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
en la oferta
Especificaciones
| Número de acceso | NP_787050 |
|---|---|
| Para utilizar con (aplicación) | Antibody Production, ELISA, Protein Array, Western Blot |
| Formulación | 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. |
| ID de gen (Entrez) | 255967 |
| Peso molecular | 37.62kDa |
| Código de producto | Marca | Cantidad | Precio | Cantidad y disponibilidad | |||||
|---|---|---|---|---|---|---|---|---|---|
| Código de producto | Marca | Cantidad | Precio | Cantidad y disponibilidad | |||||
|
16112627
|
Abnova™
H00255967-Q01.25UG |
25 ug |
en la oferta
25 microgramos |
N/A | Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo. | ||||
|
Este artículo requiere una actualización de precios antes de ser solicitado. Solicite el precio de este artículo aquí. |
|||||||||
|
16102627
|
Abnova™
H00255967-Q01.10UG |
10 ug |
en la oferta
10 microgramos |
N/A | Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo. | ||||
|
Este artículo requiere una actualización de precios antes de ser solicitado. Solicite el precio de este artículo aquí. |
|||||||||
Descripción
Sequence: ENLQKAMELVTINYSSDLKNLILYLLTDQNRMRSVNDIMPMIGARFYTQLDAAQMRNDVIEEDLAKEVQNGRLFRLLAKLGTINERPEFQKDPTWSETGDRYLLKLFREspecificaciones
| NP_787050 | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 37.62kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| PAN3 | |
| Wheat Germ (in vitro) | |
| GST | |
| Liquid |
| Antibody Production, ELISA, Protein Array, Western Blot | |
| 255967 | |
| PAN3 (Human) Recombinant Protein (Q01) | |
| ENLQKAMELVTINYSSDLKNLILYLLTDQNRMRSVNDIMPMIGARFYTQLDAAQMRNDVIEEDLAKEVQNGRLFRLLAKLGTINERPEFQKDPTWSETGDRYLLKLFR | |
| RUO | |
| PAN3 | |
| Recombinant | |
| wheat germ expression system |