missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human P11 Partial ORF (NP_006016.1, 270 a.a. - 369 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Marca: Abnova™ H00008909-Q01.10ug
Detalles adicionales : Peso : 0.00010kg
Descripción
This gene encodes a protein with protease activity. Its specific function has not been determined. The protein may be useful as a tumor marker. [provided by RefSeq]
Sequence: EGLVDYYSHIYDGPWDSYPDVLAMQFNWDGYYKEVGSAFIGSSPEFEFALYSLCFIARPGKVCQLSLGGYPLAVRTYTWDKSTYGNGKKYIATAYIVSSTEspecificaciones
| NP_006016.1 | |
| Liquid | |
| 8909 | |
| P11 (Human) Recombinant Protein (Q01) | |
| 10 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| MGC133268/PP11/PRSS26 | |
| P11 | |
| Yes | |
| wheat germ expression system |
| Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein) | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 36.74kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| EGLVDYYSHIYDGPWDSYPDVLAMQFNWDGYYKEVGSAFIGSSPEFEFALYSLCFIARPGKVCQLSLGGYPLAVRTYTWDKSTYGNGKKYIATAYIVSST | |
| RUO | |
| P11 | |
| Wheat Germ (in vitro) | |
| GST |