missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human NHLH2 Partial ORF (NP_005590.1, 36 a.a. - 135 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marca:  Abnova™ H00004808-Q01.25ug

Detalles adicionales : Peso : 0.02000kg

 Ver más versiones de este producto

Código de producto. 16024465

  • 545.00€ / 25 microgramos
Fecha estimada de envío: 13-07-2022
para ver el stock

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.


Descripción

Descripción

Sequence: SDLEPVEEAEGDGKGGSRAALYPHPQQLSREEKRRRRRATAKYRSAHATRERIRVEAFNLAFAELRKLLPTLPPDKKLSKIEILRLAICYISYLNHVLDV
Especificaciones

Especificaciones

NP_005590.1
Liquid
4808
NHLH2 (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
HEN2/KIAA0490/NSCL2/bHLHa34
NHLH2
Yes
wheat germ expression system
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.63kDa
12.5% SDS-PAGE Stained with Coomassie Blue
SDLEPVEEAEGDGKGGSRAALYPHPQQLSREEKRRRRRATAKYRSAHATRERIRVEAFNLAFAELRKLLPTLPPDKKLSKIEILRLAICYISYLNHVLDV
RUO
NHLH2
Wheat Germ (in vitro)
GST
Videos
SDS
Documentos
Certificados
Ofertas especiales

Ofertas especiales