missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human NEUROD1 Partial ORF (AAH09046, 201 a.a. - 300 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

341.70€ - 518.16€

Especificaciones

Nombre NEUROD1 (Human) Recombinant Protein (Q01)
Recombinante Yes
Para utilizar con (aplicación) Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
Peso molecular 36.63kDa
Requisitos de almacenamiento Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Ver más especificaciones

Productos 2
Código de producto Marca Cantidad Precio Cantidad y disponibilidad  
Código de producto Marca Cantidad Precio Cantidad y disponibilidad  
16118301
Ver documentos Detalles de la promoción
Abnova™
H00004760-Q01.25UG
25 ug
518.16€
25 microgramos
Ver productos alternativos
Ahorre hasta 
»
Envío estimado: 08-03-2022
Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.
16108301
Ver documentos Detalles de la promoción
Abnova™
H00004760-Q01.10UG
10 ug
341.70€
10 microgramos
Ver productos alternativos
Ahorre hasta 
»
Envío estimado: 08-03-2022
Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.
Descripción

Descripción

This gene encodes a member of the NeuroD family of basic helix-loop-helix (bHLH) transcription factors. The protein forms heterodimers with other bHLH proteins and activates transcription of genes that contain a specific DNA sequence known as the E-box. It regulates expression of the insulin gene, and mutations in this gene result in type II diabetes mellitus. [provided by RefSeq]

Sequence: QDMPPHLPTASASFPVHPYSYQSPGLPSPPYGTMDSSHVFHVKPPPHAYSAALEPFFESPLTDCTSPSFDGPLSPPLSINGNFSFKHEPSAEFEKNYAFT
Especificaciones

Especificaciones

NEUROD1 (Human) Recombinant Protein (Q01)
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Yes
36.63kDa
SDS
Product Certifications