missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human MYO6 Partial ORF (NP_004990.2, 1188 a.a. - 1285 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marca:  Abnova™ H00004646-Q01.25ug

Detalles adicionales : Peso : 0.00010kg

 Ver más versiones de este producto

Código de producto. 16191605

  • 467.00€ / 25 microgramos


Fecha estimada de envío
19-02-2021
Añadir a la cesta

Descripción

Descripción

Sequence: KKKGWWYAHFDGPWIARQMELHPDKPPILLVAGKDDMEMCELNLEETGLTRKRGAEILPRQFEEIWERCGGIQYLQNAIESRQARPTYATAMLQSLLK
Especificaciones

Especificaciones

NP_004990.2
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.52kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
KKKGWWYAHFDGPWIARQMELHPDKPPILLVAGKDDMEMCELNLEETGLTRKRGAEILPRQFEEIWERCGGIQYLQNAIESRQARPTYATAMLQSLLK
RUO
MYO6
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
4646
MYO6 (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
DFNA22|DFNB37|KIAA0389
MYO6
Yes
Videos
SDS
Documentos