missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human MSLN Partial ORF (NP_005814, 464 a.a. - 563 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Marca: Abnova™ H00010232-Q01.25ug
Detalles adicionales : Peso : 0.00010kg
Descripción
An antibody that reacts with ovarian cancers and mesotheliomas was used to isolate a cell surface antigen named mesothelin. Although the function of mesothelin is unknown, it may play a role in cellular adhesion and is present on mesothelium, mesotheliomas, and ovarian cancers. This gene encodes a preproprotein that is cleaved into two products, megakaryocyte potentiating factor and mesothelin. Alternative splicing results in multiple transcript variants. [provided by RefSeq]
Sequence: DLDTCDPRQLDVLYPKARLAFQNMNGSEYFVKIQSFLGGAPTEDLKALSQQNVSMDLATFMKLRTDAVLPLTVAEVQKLLGPHVEGLKAEERHRPVRDWIEspecificaciones
| NP_005814 | |
| Liquid | |
| 10232 | |
| MSLN (Human) Recombinant Protein (Q01) | |
| 25 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| CAK1/MPF/SMR | |
| MSLN | |
| Yes | |
| wheat germ expression system |
| Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein) | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 36.74kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| DLDTCDPRQLDVLYPKARLAFQNMNGSEYFVKIQSFLGGAPTEDLKALSQQNVSMDLATFMKLRTDAVLPLTVAEVQKLLGPHVEGLKAEERHRPVRDWI | |
| RUO | |
| MSLN | |
| Wheat Germ (in vitro) | |
| GST |