missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human LOC285141 Full-length ORF (XP_209489.1, 1 a.a. - 156 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marca:  Abnova™ H00285141-P01.25ug

Detalles adicionales : Peso : 0.00010kg

 Ver más versiones de este producto

Código de producto. 16199983

  • 458.00€ / 25 microgramos


Fecha estimada de envío
19-10-2020
Añadir a la cesta

Descripción

Descripción

Sequence: METVNEPETGEVSKDAVIVKQEKNNEYCLQDIDDKLSESAEDDGEDDTNDEDDDEDSNPKKNTQAPLELMAEFLRAEMAREYQLAKKLCQMILIYEPENPEAKEFFTLIEEMLLMEKTQNHEQDGENSDEDSSGESKGESDEELSDESSDEGEDGS
Especificaciones

Especificaciones

XP_209489.1
Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
44.1kDa
Glutathione Sepharose 4 Fast Flow
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
LOC285141
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
285141
LOC285141 (Human) Recombinant Protein (P01)
12.5% SDS-PAGE Stained with Coomassie Blue.
METVNEPETGEVSKDAVIVKQEKNNEYCLQDIDDKLSESAEDDGEDDTNDEDDDEDSNPKKNTQAPLELMAEFLRAEMAREYQLAKKLCQMILIYEPENPEAKEFFTLIEEMLLMEKTQNHEQDGENSDEDSSGESKGESDEELSDESSDEGEDGS
RUO
LOC285141
Yes
Videos
Documentos