missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human Kua-UEV Partial ORF (NP_954673, 94 a.a. - 164 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marca:  Abnova™ H00387522-Q01.10ug

Detalles adicionales : Peso : 0.00010kg

 Ver más versiones de este producto

Código de producto. 16102947

  • 341.70€ / 10 microgramos
Envío estimado: 24-01-2022

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.


Descripción

Descripción

The TMEM189-UEV mRNA is an infrequent but naturally occurring co-transcribed product of the neighboring TMEM189 and UBE2V1 genes. Ubiquitin-conjugating E2 enzyme variant proteins constitute a distinct subfamily within the E2 protein family. They have sequence similarity to other ubiquitin-conjugating enzymes but lack the conserved cysteine residue that is critical for the catalytic activity of E2s. The protein produced by this transcript has UEV1 B domains but the protein is localized to the cytoplasm rather than to the nucleus. The significance of this co-transcribed mRNA and the function of its protein product has not yet been determined. [provided by RefSeq]

Sequence: VHWGADTWGSVELPIVGKAFIRPFREHHIDPTAITRHDFIETNGDNCLVTLLPLLNMAYKFRTHSPEALEQ
Especificaciones

Especificaciones

NP_954673
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
33.55kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
VHWGADTWGSVELPIVGKAFIRPFREHHIDPTAITRHDFIETNGDNCLVTLLPLLNMAYKFRTHSPEALEQ
RUO
TMEM189-UBE2V1
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
387522
Kua-UEV (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
CROC-1B/Kua-UEV/UBE2V1
TMEM189-UBE2V1
Yes
Videos
SDS
Documentos
Certificados
Ofertas especiales

Ofertas especiales