missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human JAG1 Partial ORF (NP_000205.1, 37 a.a. - 119 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Marca: Abnova™ H00000182-Q02.25ug
Detalles adicionales : Peso : 0.00010kg
Descripción
The jagged 1 protein encoded by JAG1 is the human homolog of the Drosophilia jagged protein. Human jagged 1 is the ligand for the receptor notch 1, the latter a human homolog of the Drosophilia jagged receptor notch. Mutations that alter the jagged 1 protein cause Alagille syndrome. Jagged 1 signalling through notch 1 has also been shown to play a role in hematopoiesis. [provided by RefSeq]
Sequence: LEILSMQNVNGELQNGNCCGGARNPGDRKCTRDECDTYFKVCLKEYQSRVTAGGPCSFGSGSTPVIGGNTFNLKASRGNDRNREspecificaciones
| NP_000205.1 | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 34.76kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| LEILSMQNVNGELQNGNCCGGARNPGDRKCTRDECDTYFKVCLKEYQSRVTAGGPCSFGSGSTPVIGGNTFNLKASRGNDRNR | |
| RUO | |
| JAG1 | |
| Wheat Germ (in vitro) | |
| GST | |
| Liquid |
| Antibody Production, ELISA, Protein Array, Western Blot | |
| 182 | |
| JAG1 (Human) Recombinant Protein (Q02) | |
| 25 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| AGS/AHD/AWS/CD339/HJ1/JAGL1/MGC104644 | |
| JAG1 | |
| Recombinant | |
| wheat germ expression system |