Learn More
Abnova™ Human HOXB6 Partial ORF (NP_724779.1, 1 a.a. - 57 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Marca: Abnova™ H00003216-Q01.25ug
Detalles adicionales : Peso : 0.02000kg
Descripción
This gene is a member of the Antp homeobox family and encodes a protein with a homeobox DNA-binding domain. It is included in a cluster of homeobox B genes located on chromosome 17. The encoded protein functions as a sequence-specific transcription factor that is involved in development, including that of lung and skin, and has been localized to both the nucleus and cytoplasm. Altered expression of this gene or a change in the subcellular localization of its protein is associated with some cases of acute myeloid leukemia and colorectal cancer. [provided by RefSeq]
Sequence: MSSYFVNSTFPVTLASGQESFLGQLPLYSSGYADPLRHYPAPYGPGPGQDKGFATSSEspecificaciones
NP_724779.1 | |
Liquid | |
3216 | |
HOXB6 (Human) Recombinant Protein (Q01) | |
25 ug | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
HOX2/HOX2B/HU-2/Hox-2.2 | |
HOXB6 | |
Yes | |
wheat germ expression system |
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein) | |
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
32.01kDa | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
MSSYFVNSTFPVTLASGQESFLGQLPLYSSGYADPLRHYPAPYGPGPGQDKGFATSS | |
RUO | |
HOXB6 | |
Wheat Germ (in vitro) | |
GST |