missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human HOXA5 Partial ORF (NP_061975.1, 171 a.a. - 270 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

359.00€ - 545.00€

Especificaciones

Nombre HOXA5 (Human) Recombinant Protein (Q01)
Recombinante Yes
Para utilizar con (aplicación) Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
Peso molecular 36.74kDa
Requisitos de almacenamiento Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Ver más especificaciones

Productos 2
Código de producto Marca Cantidad Precio Cantidad y disponibilidad  
Código de producto Marca Cantidad Precio Cantidad y disponibilidad  
16024155
Ver documentos Detalles de la promoción
Abnova™
H00003202-Q01.25UG
25 ug
545.00€
25 microgramos
Ver productos alternativos
Ahorre hasta 
»
Fecha estimada de envío: 04-08-2022
para ver el stock
Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.
16014155
Ver documentos Detalles de la promoción
Abnova™
H00003202-Q01.10UG
10 ug
359.00€
10 microgramos
Ver productos alternativos
Ahorre hasta 
»
Fecha estimada de envío: 04-08-2022
para ver el stock
Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.
Descripción

Descripción

In vertebrates, the genes encoding the class of transcription factors called homeobox genes are found in clusters named A, B, C, and D on four separate chromosomes. Expression of these proteins is spatially and temporally regulated during embryonic development. This gene is part of the A cluster on chromosome 7 and encodes a DNA-binding transcription factor which may regulate gene expression, morphogenesis, and differentiation. Methylation of this gene may result in the loss of its expression and, since the encoded protein upregulates the tumor suppressor p53, this protein may play an important role in tumorigenesis. [provided by RefSeq]

Sequence: PAQPQIYPWMRKLHISHDNIGGPEGKRARTAYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLSERQIKIWFQNRRMKWKKDNKLKSMSMAAAGGAFRP
Especificaciones

Especificaciones

HOXA5 (Human) Recombinant Protein (Q01)
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Yes
36.74kDa
SDS
Product Certifications