missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human HLCS Partial ORF (NP_000402, 627 a.a. - 724 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Marca: Abnova™ H00003141-Q01.10ug
Detalles adicionales : Peso : 0.00010kg
Descripción
Holocarboxylase synthetase (EC 6.3.4.10) covalently links biotin to propionyl-CoA carboxylase (PCCA; MIM 232000), pyruvate carboxylase (PC; MIM 608786), alpha-methylcrotonyl-CoA carboxylase (MCCC1; MIM 609010), and acetyl-CoA carboxylase (ACACA; MIM 200350).[supplied by OMIM]
Sequence: ELKPLRADYLIARVVTVLEKLIKEFQDKGPNSVLPLYYRYWVHSGQQVHLGSAEGPKVSIVGLDDSGFLQVHQEGGEVVTVHPDGNSFDMLRNLILPKEspecificaciones
| NP_000402 | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 36.52kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| ELKPLRADYLIARVVTVLEKLIKEFQDKGPNSVLPLYYRYWVHSGQQVHLGSAEGPKVSIVGLDDSGFLQVHQEGGEVVTVHPDGNSFDMLRNLILPK | |
| RUO | |
| HLCS | |
| Wheat Germ (in vitro) | |
| GST | |
| Liquid |
| Antibody Production, ELISA, Protein Array, Western Blot | |
| 3141 | |
| HLCS (Human) Recombinant Protein (Q01) | |
| 10 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| HCS | |
| HLCS | |
| Recombinant | |
| wheat germ expression system |