missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human GTF2F1 Partial ORF (AAH13007.1, 418 a.a. - 517 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Marca: Abnova™ H00002962-Q01.25ug
Este artículo no se puede devolver.
Vea la política de devoluciones
Descripción
Sequence: PAAKRLRLDTGPQSLSGKSTPQPPSGKTTPNSGDVQVTEDAVRRYLTRKPMTTKDLLKKFQTKKTGLSSEQTVNVLAQILKRLNPERKMINDKMHFSLKEEspecificaciones
AAH13007.1 | |
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
36.74kDa | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
PAAKRLRLDTGPQSLSGKSTPQPPSGKTTPNSGDVQVTEDAVRRYLTRKPMTTKDLLKKFQTKKTGLSSEQTVNVLAQILKRLNPERKMINDKMHFSLKE | |
RUO | |
GTF2F1 | |
Wheat Germ (in vitro) | |
GST | |
Liquid |
Antibody Production, ELISA, Protein Array, Western Blot | |
2962 | |
GTF2F1 (Human) Recombinant Protein (Q01) | |
25 ug | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
BTF4/RAP74/TF2F1/TFIIF | |
GTF2F1 | |
Recombinant | |
wheat germ expression system |