missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human GJB6 Partial ORF (AAH38934, 45 a.a. - 75 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marca:  Abnova™ H00010804-Q01.25ug

Detalles adicionales : Peso : 0.00010kg

 Ver más versiones de este producto

Código de producto. 16195722

  • 518.16€ / 25 microgramos
Envío estimado: 20-01-2022

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.


Descripción

Descripción

Gap junctions allow the transport of ions and metabolites between the cytoplasm of adjacent cells. They are formed by two hemichannels, made up of six connexin proteins assembled in groups. Each connexin protein has four transmembrane segments, two extracellular loops, a cytoplasmic loop formed between the two inner transmembrane segments, and the N- and C-terminus both being in the cytoplasm. The specificity of the gap junction is determined by which connexin proteins comprise the hemichannel. In the past, connexin protein names were based on their molecular weight, however the new nomenclature uses sequential numbers based on which form (alpha or beta) of the gap junction is present. This gene encodes one of the connexin proteins. Mutations in this gene have been found in some forms of deafness and in some families with hidrotic ectodermal dysplasia. [provided by RefSeq]

Sequence: GDEQEDFVCNTLQPGCKNVCYDHFFPVSHIR
Especificaciones

Especificaciones

AAH38934
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
29.15kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
GDEQEDFVCNTLQPGCKNVCYDHFFPVSHIR
RUO
GJB6
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
10804
GJB6 (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
CX30/DFNA3/ED2/EDH/HED
GJB6
Yes
Videos
SDS
Documentos
Certificados
Ofertas especiales

Ofertas especiales