Learn More
Abnova™ Human FZD2 Partial ORF (NP_001457, 192 a.a. - 245 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Marca: Abnova™ H00002535-Q01.25ug
Detalles adicionales : Peso : 0.00010kg
Descripción
Members of the 'frizzled' gene family encode 7-transmembrane domain proteins that are receptors for Wnt signaling proteins. The expression of the FZD2 gene appears to be developmentally regulated, with high levels of expression in fetal kidney and lung and in adult colon and ovary. [provided by RefSeq]
Sequence: YATLEHPFHCPRVLKVPSYLSYKFLGERDCAAPCEPARPDGSMFFSQEETRFAREspecificaciones
NP_001457 | |
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
31.68kDa | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
YATLEHPFHCPRVLKVPSYLSYKFLGERDCAAPCEPARPDGSMFFSQEETRFAR | |
RUO | |
FZD2 | |
Recombinant | |
wheat germ expression system |
Antibody Production, ELISA, Protein Array, Western Blot | |
2535 | |
FZD2 (Human) Recombinant Protein (Q01) | |
25 ug | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
FZD2 | |
Wheat Germ (in vitro) | |
GST | |
Liquid |