missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human FMNL1 Partial ORF (NP_005883, 893 a.a. - 991 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Marca: Abnova™ H00000752-Q01.25ug
Detalles adicionales : Peso : 0.00010kg
Descripción
This gene encodes a formin-related protein. Formin-related proteins have been implicated in morphogenesis, cytokinesis, and cell polarity. An alternative splice variant has been described but its full length sequence has not been determined. [provided by RefSeq]
Sequence: QLTGFHSDLHFLDKAGSVSLDSVLADVRSLQRGLELTQREFVRQDDCMVLKEFLRANSPTMDKLLADSKTAQEAFESVVEYFGENPKTTSPGLFFSLFSEspecificaciones
| NP_005883 | |
| Liquid | |
| 752 | |
| FMNL1 (Human) Recombinant Protein (Q01) | |
| 25 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| C17orf1/C17orf1B/FHOD4/FMNL/KW-13/MGC133052/MGC1894/MGC21878 | |
| FMNL1 | |
| Yes | |
| wheat germ expression system |
| Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein) | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 36.63kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| QLTGFHSDLHFLDKAGSVSLDSVLADVRSLQRGLELTQREFVRQDDCMVLKEFLRANSPTMDKLLADSKTAQEAFESVVEYFGENPKTTSPGLFFSLFS | |
| RUO | |
| FMNL1 | |
| Wheat Germ (in vitro) | |
| GST |