missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human ECT2 Partial ORF (AAH06838.1, 46 a.a. - 145 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
335.00€ - 508.00€
Spécification
| Número de acceso | AAH06838.1 |
|---|---|
| Para utilizar con (aplicación) | Antibody Production, ELISA, Protein Array, Western Blot |
| Formulación | 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. |
| ID de gen (Entrez) | 1894 |
| Peso molecular | 36.63kDa |
| Code produit | Marque | Cantidad | Prix | Quantité et disponibilité | |||||
|---|---|---|---|---|---|---|---|---|---|
| Code produit | Marque | Cantidad | Prix | Quantité et disponibilité | |||||
|
16013925
|
Abnova™
H00001894-Q01.25UG |
25 ug |
508.00€
25 microgramos |
Fecha estimada de envío: 06-06-2024 Inicie sesión para ver el stock |
Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo. | ||||
|
16003925
|
Abnova™
H00001894-Q01.10UG |
10 ug |
335.00€
10 microgramos |
Fecha estimada de envío: 06-06-2024 Inicie sesión para ver el stock |
Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo. | ||||
Description
The protein encoded by this gene is a transforming protein that is related to Rho-specific exchange factors and yeast cell cycle regulators. The expression of this gene is elevated with the onset of DNA synthesis and remains elevated during G2 and M phases. In situ hybridization analysis showed that expression is at a high level in cells undergoing mitosis in regenerating liver. Thus, this protein is expressed in a cell cycle-dependent manner during liver regeneration, and is thought to have an important role in the regulation of cytokinesis. [provided by RefSeq]
Sequence: LPKENWLKMLCRHVANTICKADAENLIYTADPESFEVNTKDMDSTLSRASRAIKKTSKKVTRAFSFSKTPKRALRRALMTSHGSVEGRSPSSNDKHVMSRSpécification
| AAH06838.1 | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 36.63kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| FLJ10461/MGC138291 | |
| ECT2 | |
| Recombinant | |
| wheat germ expression system |
| Antibody Production, ELISA, Protein Array, Western Blot | |
| 1894 | |
| ECT2 (Human) Recombinant Protein (Q01) | |
| LPKENWLKMLCRHVANTICKADAENLIYTADPESFEVNTKDMDSTLSRASRAIKKTSKKVTRAFSFSKTPKRALRRALMTSHGSVEGRSPSSNDKHVMSR | |
| RUO | |
| ECT2 | |
| Wheat Germ (in vitro) | |
| GST | |
| Liquid |